PDB entry 2yca

View 2yca on RCSB PDB site
Description: Mixed-function P450 MycG in complex with mycinamicin III in P21212 space group
Class: oxidoreductase
Keywords: oxidoreductase, mycinamicin biosynthesis
Deposited on 2011-03-12, released 2012-03-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1551
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ycaa_
  • Heterogens: HEM, ZM3, GOL, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ycaA (A:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ycaA (A:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw