PDB entry 2yc1

View 2yc1 on RCSB PDB site
Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Class: immune system/toxin
Keywords: immune system-toxin complex, scorpion toxin
Deposited on 2011-03-10, released 2011-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18743
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single chain antibody fragment 9004g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YC1 (0-116)
    Domains in SCOPe 2.04: d2yc1a_
  • Chain 'B':
    Compound: single chain antibody fragment 9004g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YC1
    Domains in SCOPe 2.04: d2yc1b_
  • Chain 'C':
    Compound: beta-mammal toxin cn2
    Species: CENTRUROIDES NOXIUS HOFFMANN [TaxId:6878]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yc1c_
  • Chain 'D':
    Compound: single chain antibody fragment 9004g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YC1 (0-116)
    Domains in SCOPe 2.04: d2yc1d_
  • Chain 'E':
    Compound: single chain antibody fragment 9004g
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YC1
    Domains in SCOPe 2.04: d2yc1e_
  • Chain 'F':
    Compound: beta-mammal toxin cn2
    Species: CENTRUROIDES NOXIUS HOFFMANN [TaxId:6878]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yc1f_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yc1A (A:)
    evqlvesggglvqpggslrlsctgsgftfdnyamhwlrqvpgeglewvsgisrssgdidy
    adsvkgrftisrddakktlslqmnslraedtavyycarggvgsfdtwgqgtmvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yc1B (B:)
    ggggsggggsggggseivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqapr
    llfsdasnratgiparftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkve
    ikraaaeqkliseedlngaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yc1B (B:)
    seivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnratgip
    arftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yc1C (C:)
    kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
    pnkrcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yc1C (C:)
    kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
    pnkrc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yc1D (D:)
    evqlvesggglvqpggslrlsctgsgftfdnyamhwlrqvpgeglewvsgisrssgdidy
    adsvkgrftisrddakktlslqmnslraedtavyycarggvgsfdtwgqgtmvtvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yc1E (E:)
    ggggsggggsggggseivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqapr
    llfsdasnratgiparftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkve
    ikraaaeqkliseedlngaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yc1E (E:)
    seivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnratgip
    arftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yc1F (F:)
    kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
    pnkrcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yc1F (F:)
    kegylvdkntgckyeclklgdndyclreckqqygkgaggycyafacwcthlyeqaivwpl
    pnkrc