PDB entry 2ybv

View 2ybv on RCSB PDB site
Description: structure of rubisco from thermosynechococcus elongatus
Class: lyase
Keywords: co2/o2 specificity, carbon dioxide fixation, photosynthesis, thermostability, photorespiration, monooxygenase, hydroxylation, oxidoreductase, lyase, rubisco, chloroplast, calvin cycle, thermophilic cyanobacteria
Deposited on 2011-03-10, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19763
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybva1, d2ybva2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvb_
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvc1, d2ybvc2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvd_
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybve1, d2ybve2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvf_
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvg1, d2ybvg2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvh_
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvi1, d2ybvi2
  • Chain 'J':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvj_
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvk1, d2ybvk2
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvl_
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvm1, d2ybvm2
  • Chain 'N':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvn_
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvo1, d2ybvo2
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase small subunit
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybvp_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ybvA (A:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvA (A:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ybvB (B:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvB (B:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ybvC (C:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvC (C:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ybvD (D:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvD (D:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ybvE (E:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvE (E:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ybvF (F:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvF (F:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ybvG (G:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvG (G:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ybvH (H:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvH (H:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ybvI (I:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvI (I:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ybvJ (J:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvJ (J:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ybvK (K:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvK (K:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ybvL (L:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvL (L:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2ybvM (M:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvM (M:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2ybvN (N:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvN (N:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2ybvO (O:)
    maytqsksqkvgyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaae
    sstgtwttvwtdlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsi
    vgnvfgfkalkalrledlripvaylktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddeninsqpfqrwrdrflfvadaihkaqaetgeikghyl
    nvtaptceemlkraefakelempiimhdfltagftanttlskwcrdngmllhihramhav
    mdrqknhgihfrvlakclrmsggdhihtgtvvgklegdkavtlgfvdllrenyieqdrsr
    giyftqdwasmpgvmavasggihvwhmpalvdifgddavlqfgggtlghpwgnapgatan
    rvaleaciqarnegrdlmreggdiireaarwspelaaacelwkeikfefeaqdti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvO (O:)
    tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
    eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
    fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenin
    sqpfqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimh
    dfltagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhih
    tgtvvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhm
    palvdifgddavlqfgghpwgnapgatanrvaleaciqarnegrdlmreggdiireaarw
    spelaaac
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2ybvP (P:)
    mktlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklpl
    fnctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykpnqansgysgyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybvP (P:)
    tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
    ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp