PDB entry 2ybg

View 2ybg on RCSB PDB site
Description: structure of lys120-acetylated p53 core domain
Class: cell cycle
Keywords: cell cycle, tumor suppressor, cancer, lysine acetylation, apoptosis
Deposited on 2011-03-08, released 2011-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1768
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybga_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybgb_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybgc_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ybgd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ybgA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybgA (A:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
    cpgrdrrteeen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ybgB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybgB (B:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ybgC (C:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybgC (C:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeenl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ybgD (D:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybgD (D:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
    vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
    acpgrdrrteeenl