PDB entry 2ybf

View 2ybf on RCSB PDB site
Description: complex of rad18 (rad6 binding domain) with rad6b
Class: ligase
Keywords: ligase, e2 ubiquitin conjugating enzyme, e3 ubiquitin ligase, translesion synthesis, pcna ubiquitination
Deposited on 2011-03-08, released 2011-04-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.20099
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ybfa_
  • Chain 'B':
    Compound: e3 ubiquitin-protein ligase rad18
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BME, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ybfA (A:)
    mstparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefs
    eeypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpns
    pansqaaqlyqenkreyekrvsaiveqswnds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ybfA (A:)
    tparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefsee
    ypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpnspa
    nsqaaqlyqenkreyekrvsaiveqswnds
    

  • Chain 'B':
    No sequence available.