PDB entry 2yb6

View 2yb6 on RCSB PDB site
Description: native human rad6
Class: ligase
Keywords: ligase, translesion synthesis, ubiquitin chain synthesis
Deposited on 2011-03-02, released 2011-04-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16781
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yb6a_
  • Heterogens: BME, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yb6A (A:)
    mstparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefs
    eeypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpns
    pansqaaqlyqenkreyekrvsaiveqswnds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yb6A (A:)
    stparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefse
    eypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpnsp
    ansqaaqlyqenkreyekrvsaiveqswnd