PDB entry 2yax

View 2yax on RCSB PDB site
Description: iodoacetamide inhibited sulfur oxygenase reductase
Class: oxidoreductase
Keywords: oxidoreductase, mononuclear non-heme iron, biogeochemical sulfur cycle, thermophilic, cysteine persulphide, icosatetramer
Deposited on 2011-02-25, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1736
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yaxa_
  • Chain 'B':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yaxb_
  • Chain 'C':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yaxc_
  • Chain 'D':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yaxd_
  • Chain 'E':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yaxe_
  • Chain 'F':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yaxf_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yaxA (A:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaxA (A:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yaxB (B:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaxB (B:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yaxC (C:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaxC (C:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yaxD (D:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaxD (D:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yaxE (E:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaxE (E:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yaxF (F:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaxF (F:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne