PDB entry 2yaw

View 2yaw on RCSB PDB site
Description: hg inhibited sulfur oxygenase reductase
Class: oxidoreductase
Keywords: oxidoreductase, mononuclear non-heme iron, biogeochemical sulfur cycle, thermophilic, cysteine persulphide, icosatetramer
Deposited on 2011-02-25, released 2011-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1669
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yawa_
  • Chain 'B':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yawb_
  • Chain 'C':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yawc_
  • Chain 'D':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yawd_
  • Chain 'E':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yawe_
  • Chain 'F':
    Compound: Sulfur oxygenase/reductase
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yawf_
  • Heterogens: FE, HG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yawA (A:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yawA (A:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yawB (B:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yawB (B:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yawC (C:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yawC (C:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yawD (D:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yawD (D:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yawE (E:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yawE (E:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yawF (F:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yawF (F:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne