PDB entry 2yar

View 2yar on RCSB PDB site
Description: x-ray induced reduction of laccase from thermus thermophilus hb27 (87.5-100.0 percent dose)
Deposited on 2011-02-24, released 2012-02-29
The last revision was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laccase
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72HW2 (0-438)
      • see remark 999 (29)
  • Heterogens: CU, MPD, MRD, OH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yarA (A:)
    gpsfpepkvvrsqggllslklsatptplaiagqratlltyggsfpgptlrvrprdtvrlt
    lenrlpeptnlhwhglpispkvddpfleippgeswtyeftvpkelagtfwyhphlhgrva
    pqlfagllgalvvessldaipelreaeehllvlkdlalqggrpaphtpmdwmngkegdlv
    lvngalrptlvaqkatlrlrllnasnaryyrlalqdhplyliaadggfleeplevselll
    apgeraevlvrlrkegrfllqalpydrgamgmmdmggmahampqgpsrpetllyliapkn
    pkplplpkalspfptlpapvvtrrlvltedmmaarffingqvfdhrrvdlkgqaqtvevw
    evenqgdmdhpfhlhvhpfqvlsvggrpfpyrawkdvvnlkagevarllvplrekgrtvf
    hchivehedrgmmgvlevg