PDB entry 2yan
View 2yan on RCSB PDB site
Description: Crystal structure of the second glutaredoxin domain of human TXNL2
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on
2011-02-23, released
2011-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-01-24, with a file datestamp of
2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: glutaredoxin-3
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2yana1, d2yana2 - Chain 'B':
Compound: glutaredoxin-3
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2yanb1, d2yanb2 - Heterogens: EDO, FE, SO4, CL, GSH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2yanA (A:)
smapkleerlkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeev
rqglkaysnwptypqlyvkgelvggldivkelkengellpilrge
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2yanB (B:)
smapkleerlkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeev
rqglkaysnwptypqlyvkgelvggldivkelkengellpilrge