PDB entry 2yan

View 2yan on RCSB PDB site
Description: Crystal structure of the second glutaredoxin domain of human TXNL2
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-02-23, released 2011-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76003 (2-104)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2yana1, d2yana2
  • Chain 'B':
    Compound: glutaredoxin-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76003 (2-104)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2yanb1, d2yanb2
  • Heterogens: EDO, FE, SO4, CL, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yanA (A:)
    smapkleerlkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeev
    rqglkaysnwptypqlyvkgelvggldivkelkengellpilrge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yanB (B:)
    smapkleerlkvltnkasvmlfmkgnkqeakcgfskqileilnstgveyetfdiledeev
    rqglkaysnwptypqlyvkgelvggldivkelkengellpilrge