PDB entry 2yab

View 2yab on RCSB PDB site
Description: Crystal structure of the autoinhibited form of mouse DAPK2 in complex with AMP
Class: transferase
Keywords: apoptosis, transferase
Deposited on 2011-02-18, released 2011-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1739
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 2
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yaba_
  • Chain 'B':
    Compound: Death-associated protein kinase 2
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yabb_
  • Heterogens: AMP, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yabA (A:)
    gmetfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcre
    eierevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkq
    yvrrrwklsfsivslcnhltrslmkkvhlrtsedlrncesdteeniarrkalhprrrsst
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yabA (A:)
    tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
    revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
    ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
    fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
    qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yabB (B:)
    gmetfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcre
    eierevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkq
    yvrrrwklsfsivslcnhltrslmkkvhlrtsedlrncesdteeniarrkalhprrrsst
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yabB (B:)
    tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
    revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
    ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
    fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
    qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv