PDB entry 2yaa

View 2yaa on RCSB PDB site
Description: crystal structure of the autoinhibited form of mouse dapk2 in complex with ATP
Class: transferase
Keywords: transferase, apoptosis
Deposited on 2011-02-18, released 2011-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 2
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yaaa_
  • Chain 'B':
    Compound: Death-associated protein kinase 2
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yaab_
  • Heterogens: ATP, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yaaA (A:)
    gmetfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcre
    eierevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkq
    yvrrrwklsfsivslcnhltrslmkkvhlrtsedlrncesdteeniarrkalhprrrsst
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaaA (A:)
    etfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreei
    erevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yaaB (B:)
    gmetfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcre
    eierevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkq
    yvrrrwklsfsivslcnhltrslmkkvhlrtsedlrncesdteeniarrkalhprrrsst
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yaaB (B:)
    tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
    revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
    ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
    fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
    qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv