PDB entry 2ya9

View 2ya9 on RCSB PDB site
Description: crystal structure of the autoinhibited form of mouse dapk2
Class: transferase
Keywords: transferase, apoptosis
Deposited on 2011-02-18, released 2011-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2087
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 2
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ya9a_
  • Chain 'B':
    Compound: Death-associated protein kinase 2
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ya9b_
  • Heterogens: D1D, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ya9A (A:)
    gmetfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcre
    eierevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkq
    yvrrrwklsfsivslcnhltrslmkkvhlrtsedlrncesdteeniarrkalhprrrsst
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ya9A (A:)
    tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
    revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
    ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
    fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
    qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ya9B (B:)
    gmetfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcre
    eierevsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkq
    yvrrrwklsfsivslcnhltrslmkkvhlrtsedlrncesdteeniarrkalhprrrsst
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ya9B (B:)
    tfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvcreeie
    revsilrqvlhpniitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfikq
    ildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtpe
    fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeffs
    qtselakdfirkllvketrkrltiqealrhpwitpvdtqqamvrresvvnlenfkkqyv