PDB entry 2y9t

View 2y9t on RCSB PDB site
Description: structural basis of p63a sam domain mutants involved in aec syndrome
Class: apoptosis
Keywords: apoptosis, sterile alpha motif, 5-helix bundle
Deposited on 2011-02-16, released 2011-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tumor protein 63
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H3D4 (2-81)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2y9ta1, d2y9ta2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2y9tA (A:)
  gsyptdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkg
  ildhrqlhefsspshllrtpss