PDB entry 2y9r

View 2y9r on RCSB PDB site
Description: crystal structure of the m10 domain of titin
Class: transferase
Keywords: transferase, sarcomere, m-band, immunoglobulin domain
Deposited on 2011-02-16, released 2011-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19592
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2y9rt_
  • Heterogens: 12P, HOH

PDB Chain Sequences:

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2y9rT (T:)
    gssrgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhien
    tddlttliimdvqkqdgglytlslgnefgsdsatvnihirsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y9rT (T:)
    rgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
    lttliimdvqkqdgglytlslgnefgsdsatvnihirs