PDB entry 2y9g

View 2y9g on RCSB PDB site
Description: high-resolution structural insights on the sugar-recognition and fusion tag properties of a versatile b-trefoil lectin domain
Deposited on 2011-02-14, released 2011-10-12
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemolytic lectin lsla
    Species: LAETIPORUS SULPHUREUS [TaxId:5630]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2y9gA (A:)
    mtdiyippeglyfrllgfasrqvifarnspspdvglspvndqatdqyfsliygtgehagl
    yaikskatgkvlfsrrpaepyvgqidgdgrypdnwfkiepgktylskyfrlvqpstgtal
    vsrthlqpyfwnhpqtevfddqyftflfed
    

    Sequence, based on observed residues (ATOM records):
    >2y9gA (A:)
    diyippeglyfrllgfasrqvifarnspspdvglspvndqatdqyfsliygtgehaglya
    ikskatgkvlfsrrpaepyvgqidgdgrypdnwfkiepgktylskyfrlvqpstgtalvs
    rthlqpyfwnhpqtevfddqyftflfe