PDB entry 2y93

View 2y93 on RCSB PDB site
Description: crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356.
Class: oxidoreductase
Keywords: oxidoreductase, short chain dehydrogenase, sdr
Deposited on 2011-02-11, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.18248
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
    Species: COMAMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y93a_
  • Chain 'B':
    Compound: cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
    Species: COMAMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y93b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y93A (A:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntdlrgpsslglseqsissvpladmlksvlpigrmpaleeytgayvffatrgd
    slpatgallnydggmgvrgfltaaggadlpeklninregqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y93A (A:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntdlrgpsslgsvpladmlksvlpigrmpaleeytgayvffatrgdslpatga
    llnydggmgvrgfltaaggadlpeklnin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y93B (B:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntdlrgpsslglseqsissvpladmlksvlpigrmpaleeytgayvffatrgd
    slpatgallnydggmgvrgfltaaggadlpeklninregqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y93B (B:)
    mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
    rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
    havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
    gvapggmntdlrgpsslgsvpladmlksvlpigrmpaleeytgayvffatrgdslpatga
    llnydggmgvrgfltaaggadlpeklnin