PDB entry 2y84

View 2y84 on RCSB PDB site
Description: dntr inducer binding domain
Class: transcription
Keywords: transcription
Deposited on 2011-02-03, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2191
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84a_
  • Chain 'B':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84b_
  • Chain 'C':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84c_
  • Chain 'D':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84d_
  • Chain 'E':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84e_
  • Chain 'F':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84f_
  • Chain 'G':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84g_
  • Chain 'H':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y84h_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y84A (A:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84A (A:)
    dsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgav
    dlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghg
    evdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpak
    lpdiainlfwhakynrdpgnmwlrqlfvelfse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y84B (B:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84B (B:)
    sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
    lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge
    vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
    pdiainlfwhakynrdpgnmwlrqlfvelfsea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y84C (C:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84C (C:)
    sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
    lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge
    vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
    pdiainlfwhakynrdpgnmwlrqlfvelfsea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y84D (D:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84D (D:)
    sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
    lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge
    vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
    pdiainlfwhakynrdpgnmwlrqlfvelfse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2y84E (E:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84E (E:)
    sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
    lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge
    vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
    pdiainlfwhakynrdpgnmwlrqlfvelfse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2y84F (F:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84F (F:)
    dsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgav
    dlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghg
    evdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpak
    lpdiainlfwhakynrdpgnmwlrqlfvelfsea
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2y84G (G:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84G (G:)
    sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
    lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghge
    vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
    pdiainlfwhakynrdpgnmwlrqlfvelfsea
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2y84H (H:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y84H (H:)
    fdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfse