PDB entry 2y7w

View 2y7w on RCSB PDB site
Description: dntr inducer binding domain
Class: transcription
Keywords: transcription
Deposited on 2011-02-02, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.244
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y7wa_
  • Chain 'B':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y7wb_
  • Chain 'C':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y7wc_
  • Chain 'D':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y7wd_
  • Heterogens: SAL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y7wA (A:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7wA (A:)
    sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
    lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvagevdgll
    eragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpdiai
    nlfwhakynrdpgnmwlrqlfvelfse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y7wB (B:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7wB (B:)
    fdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnanlkedmesgavdla
    lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvatghgevdgl
    leragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpdia
    inlfwhakynrdpgnmwlrqlfvelfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y7wC (C:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7wC (C:)
    sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
    lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvahgevdgl
    leragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpdia
    inlfwhakynrdpgnmwlrqlfvelfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y7wD (D:)
    mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
    edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
    valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
    ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7wD (D:)
    fdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
    glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
    iainlfwhakynrdpgnmwlrqlfvelfse