PDB entry 2y7p

View 2y7p on RCSB PDB site
Description: dntr inducer binding domain in complex with salicylate. trigonal crystal form
Class: transcription regulator
Keywords: transcription regulator, DNA-binding, transcription, transcription factor, transcription regulation
Deposited on 2011-02-01, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. [TaxId:233098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WT50 (0-211)
      • engineered mutation (0)
      • expression tag (212-214)
    Domains in SCOPe 2.07: d2y7pa1, d2y7pa2
  • Heterogens: SAL, PEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y7pA (A:)
    mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7pA (A:)
    mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfseahhh