PDB entry 2y7k

View 2y7k on RCSB PDB site
Description: dntr inducer binding domain in complex with salicylate. monoclinic crystal form
Class: transcription
Keywords: transcription, transcription factor, lysr type, transcription regulator
Deposited on 2011-01-31, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.20252
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y7ka_
  • Chain 'B':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WT50 (Start-211)
      • expression tag (212-213)
    Domains in SCOPe 2.07: d2y7kb1, d2y7kb2
  • Chain 'C':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WT50 (0-211)
      • engineered mutation (0)
      • expression tag (0)
    Domains in SCOPe 2.07: d2y7kc1, d2y7kc2
  • Chain 'D':
    Compound: LysR-type regulatory protein
    Species: BURKHOLDERIA SP. DNT [TaxId:233098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y7kd_
  • Heterogens: SAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y7kA (A:)
    mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7kA (A:)
    dpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdla
    lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
    glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
    iainlfwhakynrdpgnmwlrqlfvelfsea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y7kB (B:)
    mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7kB (B:)
    dpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdla
    lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
    glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
    iainlfwhakynrdpgnmwlrqlfvelfseahh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y7kC (C:)
    mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7kC (C:)
    mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfsea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y7kD (D:)
    mdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
    algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
    dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
    diainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y7kD (D:)
    dpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdla
    lgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgevd
    glleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklpd
    iainlfwhakynrdpgnmwlrqlfvelfs