PDB entry 2y72

View 2y72 on RCSB PDB site
Description: crystal structure of the pkd domain of collagenase g from clostridium histolyticum at 1.18 angstrom resolution.
Deposited on 2011-01-27, released 2011-09-28
The last revision was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.14734
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagenase
    Species: Clostridium histolyticum [TaxId:1498]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X721 (3-84)
      • expression tag (0-2)
  • Chain 'B':
    Compound: collagenase
    Species: Clostridium histolyticum [TaxId:1498]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X721 (3-84)
      • expression tag (0-2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2y72A (A:)
ggtiakvtgpstgavgrniefsgkdskdedgkivsydwdfgdgatsrgknsvhaykkagt
ynvtlkvtddkgatatesftieikn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2y72B (B:)
ggtiakvtgpstgavgrniefsgkdskdedgkivsydwdfgdgatsrgknsvhaykkagt
ynvtlkvtddkgatatesftieikn