PDB entry 2y70

View 2y70 on RCSB PDB site
Description: crystallographic structure of gm23, mutant g89d, an example of catalytic migration from tim to thiamin phosphate synthase.
Class: isomerase
Keywords: isomerase
Deposited on 2011-01-27, released 2011-12-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2014
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triose-phosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-244)
      • engineered mutation (42-46)
      • insertion (47-48)
      • engineered mutation (49)
      • engineered mutation (69-73)
      • engineered mutation (75-76)
      • engineered mutation (82-83)
      • engineered mutation (88)
      • engineered mutation (129)
      • engineered mutation (142)
      • engineered mutation (192)
      • engineered mutation (211)
      • engineered mutation (244)
    Domains in SCOPe 2.01: d2y70a_
  • Chain 'B':
    Compound: triose-phosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-244)
      • engineered mutation (42-46)
      • insertion (47-48)
      • engineered mutation (49)
      • engineered mutation (69-73)
      • engineered mutation (75-76)
      • engineered mutation (82-83)
      • engineered mutation (88)
      • engineered mutation (129)
      • engineered mutation (142)
      • engineered mutation (192)
      • engineered mutation (211)
      • engineered mutation (244)
    Domains in SCOPe 2.01: d2y70b_
  • Chain 'C':
    Compound: triose-phosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-244)
      • engineered mutation (42-46)
      • insertion (47-48)
      • engineered mutation (49)
      • engineered mutation (69-73)
      • engineered mutation (75-76)
      • engineered mutation (82-83)
      • engineered mutation (88)
      • engineered mutation (129)
      • engineered mutation (142)
      • engineered mutation (192)
      • engineered mutation (211)
      • engineered mutation (244)
    Domains in SCOPe 2.01: d2y70c_
  • Chain 'D':
    Compound: triose-phosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-244)
      • engineered mutation (42-46)
      • insertion (47-48)
      • engineered mutation (49)
      • engineered mutation (69-73)
      • engineered mutation (75-76)
      • engineered mutation (82-83)
      • engineered mutation (88)
      • engineered mutation (129)
      • engineered mutation (142)
      • engineered mutation (192)
      • engineered mutation (211)
      • engineered mutation (244)
    Domains in SCOPe 2.01: d2y70d_
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y70A (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapswymgaqamtkerlshp
    kfviaaqnagnadalaslkdfgiswivldhserrayygetneivadkvaaavasgfmvia
    cigetlqerssgrtavvvltqitaiakklkkadwakvviayepvwaigtgkvatpqqaqe
    ahalirswvsskvgadvagelrilyggsvngrnartlyqqrdvngflvggaslkpefvdi
    ikate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y70B (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapswymgaqamtkerlshp
    kfviaaqnagnadalaslkdfgiswivldhserrayygetneivadkvaaavasgfmvia
    cigetlqerssgrtavvvltqitaiakklkkadwakvviayepvwaigtgkvatpqqaqe
    ahalirswvsskvgadvagelrilyggsvngrnartlyqqrdvngflvggaslkpefvdi
    ikate
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y70C (C:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapswymgaqamtkerlshp
    kfviaaqnagnadalaslkdfgiswivldhserrayygetneivadkvaaavasgfmvia
    cigetlqerssgrtavvvltqitaiakklkkadwakvviayepvwaigtgkvatpqqaqe
    ahalirswvsskvgadvagelrilyggsvngrnartlyqqrdvngflvggaslkpefvdi
    ikate
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y70D (D:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapswymgaqamtkerlshp
    kfviaaqnagnadalaslkdfgiswivldhserrayygetneivadkvaaavasgfmvia
    cigetlqerssgrtavvvltqitaiakklkkadwakvviayepvwaigtgkvatpqqaqe
    ahalirswvsskvgadvagelrilyggsvngrnartlyqqrdvngflvggaslkpefvdi
    ikate