PDB entry 2y6z

View 2y6z on RCSB PDB site
Description: Crystallographic structure of GM23 an example of Catalytic migration from TIM to thiamin phosphate synthase.
Class: isomerase
Keywords: isomerase
Deposited on 2011-01-27, released 2011-12-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1912
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triose-phosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (11-255)
      • expression tag (0-10)
      • engineered mutation (12)
      • engineered mutation (27-28)
      • engineered mutation (53-57)
      • insertion (58-59)
      • engineered mutation (60)
      • engineered mutation (80-84)
      • engineered mutation (86-87)
      • engineered mutation (93-94)
      • engineered mutation (140)
      • engineered mutation (153)
      • engineered mutation (203)
    Domains in SCOPe 2.02: d2y6za_
  • Heterogens: TPS, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2y6zA (A:)
sssglvprgsamgkpqpiaaanwkcngggqslselidlfnstsinhdvqcvvapswymga
qamtkerlshpkfviaaqnagnadalaslkdfgiswivlghserrayygetneivadkva
aavasgfmviacigetlqerssgrtavvvltqitaiakklkkadwakvviayepvwaigt
gkvatpqqaqeahalirswvsskvgadvagelrilyggsvngknartlyqqrdvngflvg
gaslkpefvdiikatq