PDB entry 2y6x

View 2y6x on RCSB PDB site
Description: structure of psb27 from thermosynechococcus elongatus
Deposited on 2011-01-27, released 2012-01-11
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photosystem II 11 kd protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2y6xA (A:)
gsnvptgltgnfredtlalisslreaialpendpnkkaaqaearkklndffalyrrddsl
rslssfmtmqtalnslaghyssypnrplpeklkarleqefkqvelaldreaks

    Sequence, based on observed residues (ATOM records):
    >2y6xA (A:)
ptgltgnfredtlalisslreaialpendpnkkaaqaearkklndffalyrrddslrsls
sfmtmqtalnslaghyssypnrplpeklkarleqefkqvelaldreaks