PDB entry 2y6t

View 2y6t on RCSB PDB site
Description: Molecular Recognition of Chymotrypsin by the Serine Protease Inhibitor Ecotin from Yersinia pestis
Class: hydrolase/inhibitor
Keywords: hydrolase-inhibitor complex
Deposited on 2011-01-26, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6ta_
  • Chain 'B':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6tb_
  • Chain 'C':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6tc_
  • Chain 'D':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6td_
  • Chain 'E':
    Compound: ecotin
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6te_
  • Chain 'F':
    Compound: ecotin
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6tf_
  • Chain 'G':
    Compound: ecotin
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6tg_
  • Chain 'H':
    Compound: ecotin
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y6th_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y6tA (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tA (A:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytantpdrlqqaslpllsntnckkywgtkikdamicaga
    sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y6tB (B:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tB (B:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytantpdrlqqaslpllsntnckkywgtkikdamicaga
    sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y6tC (C:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tC (C:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytantpdrlqqaslpllsntnckkywgtkikdamicaga
    sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y6tD (D:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tD (D:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
    sasddfaagttcvttgwgltrytantpdrlqqaslpllsntnckkywgtkikdamicaga
    sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2y6tE (E:)
    dtptplnqqqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhml
    ggnletrtlsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlp
    ivvyvpqgvevkyriweagedirsaqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tE (E:)
    qqqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhmlggnletr
    tlsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlpivvyvpq
    gvevkyriweagedirsaqvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2y6tF (F:)
    dtptplnqqqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhml
    ggnletrtlsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlp
    ivvyvpqgvevkyriweagedirsaqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tF (F:)
    nqqqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhmlggnlet
    rtlsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlpivvyvp
    qgvevkyriweagedirsaqvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2y6tG (G:)
    dtptplnqqqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhml
    ggnletrtlsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlp
    ivvyvpqgvevkyriweagedirsaqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tG (G:)
    qqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhmlggnletrt
    lsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlpivvyvpqg
    vevkyriweagedirsaqvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2y6tH (H:)
    dtptplnqqqplekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhml
    ggnletrtlsgwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlp
    ivvyvpqgvevkyriweagedirsaqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6tH (H:)
    plekiapypqaekgmsrqviflepqkdesrfkvelligktlnvdcnrhmlggnletrtls
    gwgfdylvmdkisqpastmmacpedskpqvkfvtanlgdaamqrynsrlpivvyvpqgve
    vkyriweagedirsaqvk