PDB entry 2y6o

View 2y6o on RCSB PDB site
Description: Crystal structure of EphA4 kinase domain in complex with Dasatinib.
Class: transferase
Keywords: signalling protein, transferase
Deposited on 2011-01-25, released 2011-11-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.1811
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 4
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2y6oa_
  • Heterogens: 1N1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y6oA (A:)
    nqavrefakeidascikiekvigvgefgevcsgrlkvpgkreicvaiktlkagytdkqrr
    dflseasimgqfdhpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvg
    mlrgigsgmkylsdmsyvhrdlaarnilvnsnlvckvsdfgmsrvleddpeaayttrggk
    ipirwtapeaiayrkftsasdvwsygivmwevmsygerpywdmsnqdvikaieegyrlpp
    pmdcpialhqlmldcwqkersdrpkfgqivnmldklirnpnslkrtgsess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6oA (A:)
    vrefakeidascikiekvigvgefgevcsgrlkvpgkreicvaiktlkagytdkqrrdfl
    seasimgqfdhpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvgmlr
    gigsgmkylsdmsyvhrdlaarnilvnsnlvckvsdfipirwtapeaiayrkftsasdvw
    sygivmwevmsygerpywdmsnqdvikaieegyrlpppmdcpialhqlmldcwqkersdr
    pkfgqivnmldklirnpnslkrt