PDB entry 2y6m

View 2y6m on RCSB PDB site
Description: crystal structure of epha4 kinase domain
Class: transferase
Keywords: transferase
Deposited on 2011-01-25, released 2011-11-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1764
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 4
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2y6ma_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y6mA (A:)
    nqavrefakeidascikiekvigvgefgevcsgrlkvpgkreicvaiktlkagytdkqrr
    dflseasimgqfdhpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvg
    mlrgigsgmkylsdmsyvhrdlaarnilvnsnlvckvsdfgmsrvleddpeaayttrggk
    ipirwtapeaiayrkftsasdvwsygivmwevmsygerpywdmsnqdvikaieegyrlpp
    pmdcpialhqlmldcwqkersdrpkfgqivnmldklirnpnslkrtgsess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y6mA (A:)
    vrefakeidascikiekvigvgefgevcsgrlkvpgkreicvaiktlkagytdkqrrdfl
    seasimgqfdhpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvgmlr
    gigsgmkylsdmsyvhrdlaarnilvnsnlvckvsdfpirwtapeaiayrkftsasdvws
    ygivmwevmsygerpywdmsnqdvikaieegyrlpppmdcpialhqlmldcwqkersdrp
    kfgqivnmldklirnpnslkrt