PDB entry 2y6g

View 2y6g on RCSB PDB site
Description: Cellopentaose binding mutated (X-2 L110F) CBM4-2 Carbohydrate Binding Module from a Thermostable Rhodothermus marinus Xylanase
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-01-21, released 2012-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Rhodothermus marinus [TaxId:29549]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6V8M0 (1-165)
      • expression tag (0)
      • engineered mutation (68-69)
      • engineered mutation (71)
      • engineered mutation (75)
      • engineered mutation (90)
      • engineered mutation (110)
      • engineered mutation (117)
      • cloning artifact (166)
    Domains in SCOPe 2.08: d2y6ga1, d2y6ga2, d2y6ga3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y6gA (A:)
    mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
    vngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsfdeygrlhhqq
    ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivdl