PDB entry 2y62

View 2y62 on RCSB PDB site
Description: crystal structure of leishmanial e65q-tim complexed with r-glycidol phosphate
Class: isomerase
Keywords: isomerase, fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, enzyme-ligand complex
Deposited on 2011-01-19, released 2011-12-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.1089
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase synonym triose-phosphate isomerase, tim
    Species: Leishmania mexicana [TaxId:5665]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48499 (Start-250)
      • engineered mutation (65)
    Domains in SCOPe 2.01: d2y62a_
  • Heterogens: G3P, 1GP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y62A (A:)
    msakpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpk
    yvisaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackq
    gfmviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvat
    peqaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslk
    pefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y62A (A:)
    akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
    isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
    mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
    qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
    frdiidatr