PDB entry 2y5z

View 2y5z on RCSB PDB site
Description: Mixed-function P450 MycG in complex with mycinamicin III in C2221 space group
Class: oxidoreductase
Keywords: oxidoreductase, mycinamicin biosynthesis
Deposited on 2011-01-19, released 2012-02-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.15339
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y5za_
  • Chain 'B':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y5zb_
  • Chain 'C':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y5zc_
  • Heterogens: HEM, ZM3, BEN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y5zA (A:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5zA (A:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y5zB (B:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5zB (B:)
    aepraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvr
    gpsmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvd
    qmaatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaa
    eqayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqi
    adfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtira
    gepvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevl
    lqrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y5zC (C:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5zC (C:)
    aepraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvr
    gpsmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvd
    qmaatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaa
    eqayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqi
    adfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtira
    gepvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevl
    lqrlpgirlgipetqlrwsegmllrgplelpvvw