PDB entry 2y5c

View 2y5c on RCSB PDB site
Description: Structure of human ferredoxin 2 (Fdx2)in complex with 2Fe2S cluster
Class: electron transport
Keywords: electron transport, iron-sulfur cluster biogenesis
Deposited on 2011-01-12, released 2012-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17356
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adrenodoxin-like protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P4F2 (3-108)
      • expression tag (2)
    Domains in SCOPe 2.07: d2y5ca1, d2y5ca2
  • Chain 'B':
    Compound: adrenodoxin-like protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P4F2 (3-108)
      • expression tag (2)
    Domains in SCOPe 2.07: d2y5cb1, d2y5cb2
  • Heterogens: FES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y5cA (A:)
    masdvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedh
    ldllpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5cA (A:)
    sdvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedhld
    llpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y5cB (B:)
    masdvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedh
    ldllpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5cB (B:)
    sdvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedhld
    llpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr