PDB entry 2y5b

View 2y5b on RCSB PDB site
Description: Structure of USP21 in complex with linear diubiquitin-aldehyde
Class: protein binding/hydrolase
Keywords: protein binding-hydrolase complex, ubiquitin, ubiquitin specific protease, usp, nedd8, isg15, cell signaling
Deposited on 2011-01-12, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21898
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 21
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y5ba_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-151)
      • engineered mutation (75)
    Domains in SCOPe 2.07: d2y5bb1, d2y5bb2
  • Chain 'E':
    Compound: Ubiquitin carboxyl-terminal hydrolase 21
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y5be_
  • Chain 'F':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-151)
      • engineered mutation (75)
    Domains in SCOPe 2.07: d2y5bf1, d2y5bf2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y5bA (A:)
    sddkmahhtlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggra
    qelteafadvigalwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhl
    einrrgrrappilangpvpspprrggalleepelsdddranlmwkryleredskivdlfv
    gqlksclkcqacgyrsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeelesenap
    vcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlslgdfasd
    kagspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenqvassegyvlfy
    qlmqepprcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5bA (A:)
    htlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevraqelteafadvi
    galwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrsdddra
    nlmwkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkkkvslrdcf
    nlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgv
    dfplqrlslgdfasdspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsen
    qvassegyvlfyqlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y5bB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrghmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5bB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlhmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifa
    gkqledgrtlsdyniqkestlhlvlrlrgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2y5bE (E:)
    sddkmahhtlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqevpgggra
    qelteafadvigalwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhl
    einrrgrrappilangpvpspprrggalleepelsdddranlmwkryleredskivdlfv
    gqlksclkcqacgyrsttfevfcdlslpipkkgfaggkvslrdcfnlftkeeelesenap
    vcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsikkssvgvdfplqrlslgdfasd
    kagspvyqlyalcnhsgsvhyghytalcrcqtgwhvyndsrvspvsenqvassegyvlfy
    qlmqepprcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y5bE (E:)
    hhtlllgsghvglrnlgntcflnavlqclsstrplrdfclrrdfrqeraqelteafadvi
    galwhpdsceavnptrfravfqkyvpsfsgysqqdaqeflkllmerlhleinrrgeepel
    sdddranlmwkryleredskivdlfvgqlksclkcqacgyrsttfevfcdlslpipkgkv
    slrdcfnlftkeeelesenapvcdrcrqktrstkkltvqrfprilvlhlnrfsasrgsik
    kssvgvdfplqrlslgdfasdkagspvyqlyalcnhsgsvhyghytalcrcqtgwhvynd
    srvspvsenqvassegyvlfyqlmq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y5bF (F:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrghmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg