PDB entry 2y4w

View 2y4w on RCSB PDB site
Description: Solution structure of human ubiquitin conjugating enzyme Rad6b
Class: ligase
Keywords: ligase, DNA damage, DNA repair, ubiquitination
Deposited on 2011-01-11, released 2011-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y4wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y4wA (A:)
    mstparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefs
    eeypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpns
    pansqaaqlyqenkreyekrvsaiveqswnds