PDB entry 2y4w

View 2y4w on RCSB PDB site
Description: Solution structure of human ubiquitin conjugating enzyme Rad6b
Class: ligase
Keywords: ligase, DNA damage, DNA repair, ubiquitination
Deposited on 2011-01-11, released 2011-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-conjugating enzyme e2 b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63146 (0-151)
  Domains in SCOPe 2.08: d2y4wa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2y4wA (A:)
  mstparrrlmrdfkrlqedppvgvsgapsennimqwnavifgpegtpfedgtfklviefs
  eeypnkpptvrflskmfhpnvyadgsicldilqnrwsptydvssiltsiqslldepnpns
  pansqaaqlyqenkreyekrvsaiveqswnds