PDB entry 2y4q

View 2y4q on RCSB PDB site
Description: solution structure of the ef-hand domain of human polycystin 2
Deposited on 2011-01-07, released 2011-12-21
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polycystin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PKD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13563 (3-78)
      • expression tag (0-2)
  • Heterogens: CA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2y4qA (A:)
ggslkkntvddiseslrqgggklnfdelrqdlkgkghtdaeieaiftkydqdgdqelteh
ehqqmrddlekeredldld