PDB entry 2y4p

View 2y4p on RCSB PDB site
Description: Dimeric structure of DAPK-1 catalytic domain
Class: transferase
Keywords: calmodulin-binding, serine/threonine-protein kinase, nucleotide-binding, apoptosis, transferase, ATP-binding
Deposited on 2011-01-07, released 2012-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.25465
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y4pa_
  • Chain 'B':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y4pb_
  • Chain 'C':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y4pc_
  • Chain 'D':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y4pd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y4pA (A:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y4pA (A:)
    frqenvddyydtgeelgsgfavvkkcrekstglqyaakfikkrredierevsilkeiqhp
    nvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqilngvyylhslq
    iahfdlkpenimlldrnvpkprikiidfglahkidtpefvapeivnyeplgleadmwsig
    vityillsgaspflgdtkqetlanvsavnyefedeyfsntsalakdfirrllvkdpkkrm
    tiqdslqhpwi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y4pB (B:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y4pB (B:)
    sredierevsilkeiqhpnvitlggelfdflaekeslteeeateflkqilngvyylhslq
    iahfdlkpenimllprikiidfglahkidpefvapeivnyeplgleadmwsigvityill
    sgaspflgdtkqetlanvsavnyefedeyfsntsalakdfirrllvkdpkkrmtiqdslq
    hpwi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y4pC (C:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y4pC (C:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidtpefvapeivny
    eplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfstsalakdfi
    rrllvkdpkkrmtiqdslqhpwik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y4pD (D:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y4pD (D:)
    vsredierevsilkeiqhpnvitlhevlelvaggelfdflaeeeateflkqilngvyylh
    slqiahfdlkpenimlldrnvpkprikiidfglahkidpefvapeivnyeplgleadmws
    igvityillsgaspflgdtkqetlanvsavnyefedeyfsntsalakdfirrllvkdpkk
    rmtiqdslqhpwik