PDB entry 2y46

View 2y46 on RCSB PDB site
Description: Structure of the mixed-function P450 MycG in complex with mycinamicin IV
Class: oxidoreductase
Keywords: oxidoreductase, mycinamicin biosynthesis
Deposited on 2011-01-05, released 2012-01-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y46a_
  • Chain 'B':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y46b_
  • Chain 'C':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y46c_
  • Heterogens: HEM, MIV, BEN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y46A (A:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y46A (A:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y46B (B:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y46B (B:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y46C (C:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y46C (C:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw