PDB entry 2y3w

View 2y3w on RCSB PDB site
Description: n-terminal head domain and beginning of coiled coil domain of danio rerio sas-6
Deposited on 2010-12-27, released 2011-02-09
The last revision was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spindle assembly abnormal protein 6 homolog
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZVT3 (3-End)
      • expression tag (1-2)
      • see remark 999 (104)
      • engineered mutation (133)
  • Chain 'B':
    Compound: spindle assembly abnormal protein 6 homolog
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZVT3 (3-End)
      • see remark 999 (104)
      • engineered mutation (133)
  • Chain 'C':
    Compound: spindle assembly abnormal protein 6 homolog
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZVT3
      • see remark 999 (104)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2y3wA (A:)
    gphmtellfnkrlqvlvkskdtderrsvirvsielqlpsspvhrkdlvvrltddtdlyfl
    ynliiseedfqslkvqqgllidftsfpqkfidlleqciceqdkenprfllqlsssssafd
    hspsnlnivetnadkhlthlslkllpgsdtdikkylasclssvkeekqqlqqklrkteed
    lt
    

    Sequence, based on observed residues (ATOM records):
    >2y3wA (A:)
    phmtellfnkrlqvlvkskdtderrsvirvsielqlpkdlvvrltddtdlyflynliise
    edfqslkvqqgllidftsfpqkfidlleqciceqdkenprfllqlsssssafdhspsnln
    ivetnadkhlthlslkllpgsdtdikkylasclssvkeekqqlqqklrktee
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2y3wB (B:)
    gphmtellfnkrlqvlvkskdtderrsvirvsielqlpsspvhrkdlvvrltddtdlyfl
    ynliiseedfqslkvqqgllidftsfpqkfidlleqciceqdkenprfllqlsssssafd
    hspsnlnivetnadkhlthlslkllpgsdtdikkylasclssvkeekqqlqqklrkteed
    lt
    

    Sequence, based on observed residues (ATOM records):
    >2y3wB (B:)
    mtellfnkrlqvlvkerrsvirvsielqlpsspvhrkdlvvrltddtdlyflynliisee
    dfqslkvqqgllidftsfpqkfidlleqciceqdkenprfllqlsshspsnlnivetnad
    khlthlslkllpgsdtdikkylasclssvkeekqqlqqklrkteed
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2y3wC (C:)
    gphmtellfnkrlqvlvkskdtderrsvirvsielqlpsspvhrkdlvvrltddtdlyfl
    ynliiseedfqslkvqqgllidftsfpqkfidlleqciceqdkenprfllqlsssssafd
    hspsnlnivetnadkhlthlslkllpgsdtdikkylasclssvkeekqqlqqklrkteed
    lt
    

    Sequence, based on observed residues (ATOM records):
    >2y3wC (C:)
    tellfnkrlqvlvrrsvirvsielqlvvrltddtdlyflynliiedfqslkvdftsfpqk
    fidlleqciceqdkenprfllqlssspsnlnivetlslkllpg