PDB entry 2y3n

View 2y3n on RCSB PDB site
Description: Type II cohesin-dockerin domain from Bacteroides cellolosolvens
Class: structrual protein/hydrolase
Keywords: structrual protein-hydrolase complex, cellulosome
Deposited on 2010-12-22, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16641
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulosomal scaffoldin
    Species: Bacteroides cellulosolvens [TaxId:35825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FDJ9 (3-172)
      • expression tag (2)
      • expression tag (173-174)
    Domains in SCOPe 2.07: d2y3na1, d2y3na2, d2y3na3
  • Chain 'B':
    Compound: cellulosomal family-48 processive glycoside hydrolase
    Species: Bacteroides cellulosolvens [TaxId:35825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UB36 (1-End)
      • expression tag (0)
      • conflict (49-50)
    Domains in SCOPe 2.07: d2y3nb1, d2y3nb2
  • Chain 'C':
    Compound: cellulosomal scaffoldin
    Species: Bacteroides cellulosolvens [TaxId:35825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FDJ9 (3-172)
      • expression tag (2)
    Domains in SCOPe 2.07: d2y3nc1, d2y3nc2
  • Chain 'D':
    Compound: cellulosomal family-48 processive glycoside hydrolase
    Species: Bacteroides cellulosolvens [TaxId:35825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UB36 (1-End)
      • expression tag (0)
      • conflict (49-50)
    Domains in SCOPe 2.07: d2y3nd1, d2y3nd2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y3nA (A:)
    masgsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytd
    stmpdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkv
    ikeipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypklehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3nA (A:)
    sgsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdst
    mpdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvik
    eipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypkle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y3nB (B:)
    mfvklkgdlngdgvinmadvmilaqsfgkaignpgvnekadlnndgvinsddaiilaqyf
    gktksaevvmf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3nB (B:)
    mfvklkgdlngdgvinmadvmilaqsfgkaiekadlnndgvinsddaiilaqyfgktksa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y3nC (C:)
    masgsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytd
    stmpdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkv
    ikeipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypklehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3nC (C:)
    sgsvltaidndkvavgdkvtltinvdkitnfsgyqfnikynttylqpwdtiadeaytdst
    mpdygtllqgrfnatdmskhnlsqgvlnfgrlymnlsayrasgkpestgavakvtfkvik
    eipaegiklatfengssmnnavdgtmlfdwdgnmysssaykvvqpgliypk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y3nD (D:)
    mfvklkgdlngdgvinmadvmilaqsfgkaignpgvnekadlnndgvinsddaiilaqyf
    gktksaevvmf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3nD (D:)
    mfvklkgdlngdgvinmadvmilaqsfgkdgvinsddaiilaqyfgktk