PDB entry 2y3i

View 2y3i on RCSB PDB site
Description: the structure of the fully closed conformation of human pgk in complex with l-ADP, 3pg and the tsa aluminium tetrafluoride
Class: transferase
Keywords: transferase, aids, hepatitis, cancer, l-nucleoside analogues, glycolysis
Deposited on 2010-12-21, released 2011-04-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2647
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00558 (Start-415)
      • conflict (2)
    Domains in SCOPe 2.01: d2y3ia_
  • Chain 'D':
    Compound: Phosphoglycerate kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00558 (Start-415)
      • conflict (2)
    Domains in SCOPe 2.01: d2y3id_
  • Heterogens: MG, CL, LA8, ALF, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y3iA (A:)
    msmsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
    mshlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsville
    nlrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvn
    lpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggm
    aftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
    atvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevv
    katsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3iA (A:)
    msnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
    hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
    rfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlp
    qkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaf
    tflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqat
    vasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvka
    tsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y3iD (D:)
    msmsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvl
    mshlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsville
    nlrfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvn
    lpqkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggm
    aftflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgq
    atvasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevv
    katsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3iD (D:)
    msnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaavpsikfcldngaksvvlms
    hlgrpdgvpmpdkyslepvavelksllgkdvlflkdcvgpevekacanpaagsvillenl
    rfhveeegkgkdasgnkvkaepakieafraslsklgdvyvndafgtahrahssmvgvnlp
    qkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggmaf
    tflkvlnnmeigtslfdeegakivkdlmskaekngvkitlpvdfvtadkfdenaktgqat
    vasgipagwmgldcgpesskkyaeavtrakqivwngpvgvfeweafargtkalmdevvka
    tsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsn