PDB entry 2y3f

View 2y3f on RCSB PDB site
Description: traptavidin, biotin bound form
Class: biotin-binding protein
Keywords: biotin-binding protein, protein engineering
Deposited on 2010-12-20, released 2011-02-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.1358
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (40-41)
    Domains in SCOPe 2.01: d2y3fa_
  • Heterogens: BTN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y3fA (A:)
    maeagitgtwynqlgstfivtagadgaltgtyesavgnaegdyvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
    kvkpsaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3fA (A:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaegdyvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    p