PDB entry 2y3e

View 2y3e on RCSB PDB site
Description: traptavidin, apo-form
Class: biotin-binding protein
Keywords: biotin-binding protein, protein engineering
Deposited on 2010-12-20, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.1353
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (40-41)
    Domains in SCOPe 2.07: d2y3ea_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (40-41)
    Domains in SCOPe 2.07: d2y3eb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y3eA (A:)
    maeagitgtwynqlgstfivtagadgaltgtyesavgnaegdyvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
    kvkpsaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3eA (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaegdyvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y3eB (B:)
    maeagitgtwynqlgstfivtagadgaltgtyesavgnaegdyvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtft
    kvkpsaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y3eB (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaegdyvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp