PDB entry 2y37

View 2y37 on RCSB PDB site
Description: the discovery of novel, potent and highly selective inhibitors of inducible nitric oxide synthase (inos)
Class: oxidoreductase
Keywords: drug design, oxidoreductase
Deposited on 2010-12-19, released 2011-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2097
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2y37a_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2y37b_
  • Heterogens: SO4, GOL, A54, HEM, H4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y37A (A:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y37A (A:)
    qyvriknwgsgeilhdtlhhkatclgsimnpksltrgprdkptpleellphaiefinqyy
    gsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqv
    fdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyq
    mpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtm
    ehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryni
    leevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqney
    rarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y37B (B:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y37B (B:)
    qyvriknwgsgeilhdtlhhkatsclgsimnpksltrgprdkptpleellphaiefinqy
    ygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlq
    vfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagy
    qmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevt
    mehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryn
    ileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqne
    yrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq