PDB entry 2y2y

View 2y2y on RCSB PDB site
Description: Oxidised form of E. coli CsgC
Deposited on 2010-12-16, released 2011-09-21
The last revision was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2647
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: curli production protein csgc
    Species: ESCHERICHIA COLI O157:H7 STR. EC4115 [TaxId:444450]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2y2yA (A:)
mgssqitfnttqqgdmytiipevtltqsclcrvqilslregssgqsqtkqektlslpanq
pialtklslnispddrvkivvtvsdgqslhlsqqwppssekslehhhhhh

    Sequence, based on observed residues (ATOM records):
    >2y2yA (A:)
ssqitfnttqqgdmytiipevtltqsclcrvqilslregssgqsqtkqektlslpanqpi
altklslnispddrvkivvtvsdgqslhlsqqwpp