PDB entry 2y2x

View 2y2x on RCSB PDB site
Description: Crystal Structure of Pseudomonas Aeruginosa OpdK with Vanillate
Class: membrane protein
Keywords: membrane protein, outer membrane, oprd, transport
Deposited on 2010-12-16, released 2011-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.18
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanillate porin opdk
    Species: PSEUDOMONAS AERUGINOSA PA01 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2y2xa_
  • Chain 'B':
    Compound: vanillate porin opdk
    Species: PSEUDOMONAS AERUGINOSA PA01 [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2y2xb_
  • Heterogens: EDO, C8E, VNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y2xA (A:)
    aeggfledaktdlvlrnyyfnrdfrdhdagkslvdewaqgfilkfssgytpgtvgvglda
    iglfgvklnsgrgtsnsellplhddgraadnygrvgvaaklrvsaselkigemlpdipll
    ryddgrllpqtfrgfavvsrelpglalqagrfdavslrnsadmqdlsawsaptqksdgfn
    yagaeyrfnrertqlglwhgqledvyrqsyanllhkqrvgdwtlganlglfvdrddgaar
    ageidshtvyglfsagiglhtfylglqkvggdsgwqsvygssgrsmgndmfngnftnade
    rswqvrydydfvglgwpgligmvryghgsnattkagsggkewerdvelgytvqsgplarl
    nvrlnhasnrrsfnsdfdqtrlvvsyplsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y2xA (A:)
    gfledaktdlvlrnyyfnrdflvdewaqgfilkfssgytpgtvgvgldaiglfgvklnsn
    sellplhddgraadnygrvgvaaklrvsaselkigemlpdipllryddgrllpqtfrgfa
    vvsrelpglalqagrfdavslrnsadmqdlsawsaptqksdgfnyagaeyrfnrertqlg
    lwhgqledvyrqsyanllhkqrvgdwtlganlglfvdrddgaarageidshtvyglfsag
    iglhtfylglqkvggdsgwqsvygssgrsmgndmfngnftnaderswqvrydydfvglgw
    pgligmvryghgsnattkagsggkewerdvelgytvqsgplarlnvrlnhasnrrsfnsd
    fdqtrlvvsyplsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y2xB (B:)
    aeggfledaktdlvlrnyyfnrdfrdhdagkslvdewaqgfilkfssgytpgtvgvglda
    iglfgvklnsgrgtsnsellplhddgraadnygrvgvaaklrvsaselkigemlpdipll
    ryddgrllpqtfrgfavvsrelpglalqagrfdavslrnsadmqdlsawsaptqksdgfn
    yagaeyrfnrertqlglwhgqledvyrqsyanllhkqrvgdwtlganlglfvdrddgaar
    ageidshtvyglfsagiglhtfylglqkvggdsgwqsvygssgrsmgndmfngnftnade
    rswqvrydydfvglgwpgligmvryghgsnattkagsggkewerdvelgytvqsgplarl
    nvrlnhasnrrsfnsdfdqtrlvvsyplsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y2xB (B:)
    gfledaktdlvlrnyyfnrdfrdlvdewaqgfilkfssgytpgtvgvgldaiglfgvkln
    sgtsnellplhddgraadnygrvgvaaklrvsaselkigemlpdipllryddgrllpqtf
    rgfavvsrelpglalqagrfdavslrnsadmqdlsawsaptqksdgfnyagaeyrfnrer
    tqlglwhgqledvyrqsyanllhkqrvgdwtlganlglfvdrddgaarageidshtvygl
    fsagiglhtfylglqkvggdsgwqsvygssgrsmgndmfngnftnaderswqvrydydfv
    glgwpgligmvryghgsnattkagsggkewerdvelgytvqsgplarlnvrlnhasnrrs
    fnsdfdqtrlvvsyplsw