PDB entry 2y24

View 2y24 on RCSB PDB site
Description: structural basis for substrate recognition by erwinia chrysanthemi gh5 glucuronoxylanase
Class: hydrolase
Keywords: hydrolase, glucuronoxylan-specific xylanase, gh5 family, aldotetraouronic acid
Deposited on 2010-12-13, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.12206
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: ERWINIA CHRYSANTHEMI [TaxId:556]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y24a1, d2y24a2
  • Heterogens: PG4, PGE, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2y24A (A:)
    dtvkidanvnyqiiqgfggmsgvgwindltteqintaygsgvgqiglsimrvridpdssk
    wniqlpsarqavslgakimatpwsppaymksnnslinggrllpanysaytshlldfskym
    qtngaplyaisiqnepdwkpdyescewsgdefksylksqgskfgslkvivaeslgfnpal
    tdpvlkdsdaskyvsiigghlygttpkpyplaqnagkqlwmtehyvdskqsannwtsaie
    vgtelnasmvsnysayvwwyirrsyglltedgkvskrgyvmsqyarfvrpgalriqaten
    pqsnvhltaykntdgkmvivavntndsdqmlslnisnanvtkfekystsaslnveyggss
    qvdssgkatvwlnplsvttfvsk