PDB entry 2y1t

View 2y1t on RCSB PDB site
Description: bacillus subtilis prophage dutpase in complex with dudp
Class: hydrolase
Keywords: hydrolase, spb prophage, phe-lid
Deposited on 2010-12-10, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.142
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y1ta_
  • Chain 'B':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y1tb_
  • Chain 'C':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y1tc_
  • Chain 'D':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y1td_
  • Chain 'E':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y1te_
  • Chain 'F':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y1tf_
  • Heterogens: DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y1tA (A:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y1tA (A:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y1tB (B:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y1tB (B:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2y1tC (C:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y1tC (C:)
    mqikikyldetqtrinqgdwidlraaedvaikkdefklvplgvamelpegyeahvvprss
    tyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavdli
    evdrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2y1tD (D:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y1tD (D:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2y1tE (E:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y1tE (E:)
    mqikikyldetqtrinkmqgdwidlraaedvaikkdefklvplgvamelpegyeahvvpr
    sstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavd
    lievdrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2y1tF (F:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y1tF (F:)
    mqikikyldetqtrinkeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvpr
    sstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavd
    lievdrl