PDB entry 2y1s

View 2y1s on RCSB PDB site
Description: microvirin lectin
Deposited on 2010-12-10, released 2011-04-06
The last revision was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannan-binding lectin
    Species: Microcystis aeruginosa [TaxId:1126]
    Gene: mvn, IPF_3128
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2MDE2 (0-107)
      • conflict (63)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2y1sA (A:)
mpnfshtcssinydpdstilsaecqardgewlptelrlsdhignidgelqfgdqnfqetc
qdcrlefgdgeqsvwlvctcqtmdgewkstqilldsqidnndsqleig