PDB entry 2y1b

View 2y1b on RCSB PDB site
Description: crystal structure of the e. coli outer membrane lipoprotein rcsf
Deposited on 2010-12-07, released 2011-03-16
The last revision was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative outer membrane protein, signal
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: I3C, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2y1bA (A:)
mgsmlsrspvepvqstapqpkaepakpkapratpvriytnaeelvgkpfrdlgevsgdsc
qasnqdsppsiptarkrmqinaskmkanavllhscevtsgtpgcyrqavcigsalnitak
lehhhhhh

    Sequence, based on observed residues (ATOM records):
    >2y1bA (A:)
tpvriytnaeelvgkpfrdlgevsgdscqasnqdsppsiptarkrmqinaskmkanavll
hscevtsgtpgcyrqavcigsalnit